PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015882900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 172aa    MW: 18710.4 Da    PI: 8.6122
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015882900.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.43.3e-45131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da++s+vyeA+ar+rdPvyG++g i++l+qq+e l+a+la
  XP_015882900.1  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPMHQRGDAVKSMVYEANARVRDPVYGCAGAISSLHQQIEVLQAQLA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  XP_015882900.1 108 LAQAE 112
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.45512113IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESGRKQGA PSPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE  60
LPMHQRGDAV KSMVYEANAR VRDPVYGCAG AISSLHQQIE VLQAQLALAQ AEVVHLRVRQ  120
TASMSNHVLS PTSPSNSGSP SSSKFIGSQA KPIFDMDMAV DHTGFAESMW SC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882900.11e-127PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE98e-78LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0D2UNR81e-100A0A0D2UNR8_G
STRINGPOPTR_0001s11610.14e-97(Populus trichocarpa)
STRINGPOPTR_0003s14880.14e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.16e-74LOB domain-containing protein 4